tynans.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | |
| Description | N/A |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 64.70.56.99 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
tynans.com Valuation
|
US$5,452,392
Last updated:
tynans.com has Semrush global rank of 1,941,222. tynans.com has an estimated worth of US$ 5,452,392, based on its estimated Ads revenue. tynans.com receives approximately 629,123 unique visitors each day. Its web server is located in United States, with IP address 64.70.56.99. According to SiteAdvisor, tynans.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$5,452,392 |
| Daily Ads Revenue | US$5,033 |
| Monthly Ads Revenue | US$150,990 |
| Yearly Ads Revenue | US$1,811,872 |
| Daily Unique Visitors | 41,942 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| tynans.com. | A | 3598 | IP: 64.70.56.99 |
| tynans.com. | NS | 3600 | NS Record: dns177.d.register.com. |
| tynans.com. | NS | 3600 | NS Record: dns061.a.register.com. |
| tynans.com. | NS | 3600 | NS Record: dns017.c.register.com. |
| tynans.com. | NS | 3600 | NS Record: dns221.b.register.com. |
| tynans.com. | MX | 3600 | MX Record: 10 in.hes.trendmicro.com. |
| tynans.com. | TXT | 3600 | TXT Record: v=spf1 mx a ip4:65.158.61.18/32 ip4:70.90.116.233/29 a:remote.tynans.com include:spf.hes.trendmicro.com include:dealermarketingservicesspfmtp.com ip4:207.187.164.0/24 include:_spf.hosting.cdkglobal.com ~all |
| tynans.com. | TXT | 3600 | TXT Record: MS=A024223C152916F1833FB6E84255F57BF3E3243E |
| tynans.com. | TXT | 3600 | TXT Record: h3d7vce84ntt5007eaee8q300s |
HTTP Headers
HTTP/1.1 301 Moved Permanently Server: nginx/1.18.0 Date: Mon, 20 Dec 2021 14:58:04 GMT Content-Type: text/html Content-Length: 169 Connection: keep-alive Location: http://www.tynans.com/ HTTP/1.1 301 Moved Permanently Server: nginx Cache-Control: no-store Location: https://www.tynans.com/ Content-Length: 0 Date: Mon, 20 Dec 2021 14:58:04 GMT Connection: keep-alive Set-Cookie: DDC.postalCode=07101; Max-Age=86400; Expires=Tue, 21-Dec-2021 14:58:04 GMT; Path=/ Set-Cookie: JSESSIONID=A1C952E4100074934525E917315FB0E9; Path=/; HttpOnly Set-Cookie: locale=en_US; Max-Age=2592000; Expires=Wed, 19-Jan-2022 14:58:04 GMT; Path=/ HTTP/2 200 server: nginx content-type: text/html;charset=utf-8 cache-control: no-store date: Mon, 20 Dec 2021 14:58:06 GMT set-cookie: DDC.postalCode=07101; Max-Age=86400; Expires=Tue, 21-Dec-2021 14:58:06 GMT; Path=/ set-cookie: JSESSIONID=6F7C8CCA1C87B09B1E304A93C971840D; Path=/; HttpOnly set-cookie: locale=en_US; Max-Age=2592000; Expires=Wed, 19-Jan-2022 14:58:06 GMT; Path=/ set-cookie: ddc_diag_akam_clientIP=66.94.110.74; expires=Mon, 20-Dec-2021 15:13:06 GMT set-cookie: ddc_diag_akam_currentTime=1640012286; expires=Mon, 20-Dec-2021 15:13:06 GMT set-cookie: ddc_diag_akam_requestID=71e894c6; expires=Mon, 20-Dec-2021 15:13:06 GMT set-cookie: ddc_diag_akam_ghostIP=104.76.198.145; expires=Mon, 20-Dec-2021 15:13:06 GMT set-cookie: ddc_diag_akam_fullPath=/; expires=Mon, 20-Dec-2021 15:13:06 GMT x-akam-sw-version: 0.5.0 |
tynans.com Whois Information
Domain Name: TYNANS.COM Registry Domain ID: 130310_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.srsplus.com Registrar URL: http://www.srsplus.com Updated Date: 2015-01-23T22:09:55Z Creation Date: 1997-01-30T05:00:00Z Registry Expiry Date: 2024-01-31T05:00:00Z Registrar: TLDS L.L.C. d/b/a SRSPlus Registrar IANA ID: 320 Registrar Abuse Contact Email: abuse@web.com Registrar Abuse Contact Phone: +1.8003337680 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DNS1.SRSPLUS.COM Name Server: DNS2.SRSPLUS.COM DNSSEC: unsigned >>> Last update of whois database: 2021-12-24T08:37:52Z <<< |