tynans.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title
Description N/A
Keywords N/A
Server Information
WebSite tynans favicontynans.com
Host IP 64.70.56.99
Location United States
Related Websites
Site Rank
More to Explore
tynans.com Valuation
US$5,452,392
Last updated:

tynans.com has Semrush global rank of 1,941,222. tynans.com has an estimated worth of US$ 5,452,392, based on its estimated Ads revenue. tynans.com receives approximately 629,123 unique visitors each day. Its web server is located in United States, with IP address 64.70.56.99. According to SiteAdvisor, tynans.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$5,452,392
Daily Ads Revenue US$5,033
Monthly Ads Revenue US$150,990
Yearly Ads Revenue US$1,811,872
Daily Unique Visitors 41,942
Note: All traffic and earnings values are estimates.
DNS Records
Host Type TTL Data
tynans.com. A 3598 IP: 64.70.56.99
tynans.com. NS 3600 NS Record: dns177.d.register.com.
tynans.com. NS 3600 NS Record: dns061.a.register.com.
tynans.com. NS 3600 NS Record: dns017.c.register.com.
tynans.com. NS 3600 NS Record: dns221.b.register.com.
tynans.com. MX 3600 MX Record: 10 in.hes.trendmicro.com.
tynans.com. TXT 3600 TXT Record: v=spf1 mx a ip4:65.158.61.18/32 ip4:70.90.116.233/29 a:remote.tynans.com include:spf.hes.trendmicro.com include:dealermarketingservicesspfmtp.com ip4:207.187.164.0/24 include:_spf.hosting.cdkglobal.com ~all
tynans.com. TXT 3600 TXT Record: MS=A024223C152916F1833FB6E84255F57BF3E3243E
tynans.com. TXT 3600 TXT Record: h3d7vce84ntt5007eaee8q300s
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: nginx/1.18.0
Date: Mon, 20 Dec 2021 14:58:04 GMT
Content-Type: text/html
Content-Length: 169
Connection: keep-alive
Location: http://www.tynans.com/

HTTP/1.1 301 Moved Permanently
Server: nginx
Cache-Control: no-store
Location: https://www.tynans.com/
Content-Length: 0
Date: Mon, 20 Dec 2021 14:58:04 GMT
Connection: keep-alive
Set-Cookie: DDC.postalCode=07101; Max-Age=86400; Expires=Tue, 21-Dec-2021 14:58:04 GMT; Path=/
Set-Cookie: JSESSIONID=A1C952E4100074934525E917315FB0E9; Path=/; HttpOnly
Set-Cookie: locale=en_US; Max-Age=2592000; Expires=Wed, 19-Jan-2022 14:58:04 GMT; Path=/

HTTP/2 200 
server: nginx
content-type: text/html;charset=utf-8
cache-control: no-store
date: Mon, 20 Dec 2021 14:58:06 GMT
set-cookie: DDC.postalCode=07101; Max-Age=86400; Expires=Tue, 21-Dec-2021 14:58:06 GMT; Path=/
set-cookie: JSESSIONID=6F7C8CCA1C87B09B1E304A93C971840D; Path=/; HttpOnly
set-cookie: locale=en_US; Max-Age=2592000; Expires=Wed, 19-Jan-2022 14:58:06 GMT; Path=/
set-cookie: ddc_diag_akam_clientIP=66.94.110.74; expires=Mon, 20-Dec-2021 15:13:06 GMT
set-cookie: ddc_diag_akam_currentTime=1640012286; expires=Mon, 20-Dec-2021 15:13:06 GMT
set-cookie: ddc_diag_akam_requestID=71e894c6; expires=Mon, 20-Dec-2021 15:13:06 GMT
set-cookie: ddc_diag_akam_ghostIP=104.76.198.145; expires=Mon, 20-Dec-2021 15:13:06 GMT
set-cookie: ddc_diag_akam_fullPath=/; expires=Mon, 20-Dec-2021 15:13:06 GMT
x-akam-sw-version: 0.5.0
tynans.com Whois Information
Domain Name: TYNANS.COM
Registry Domain ID: 130310_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.srsplus.com
Registrar URL: http://www.srsplus.com
Updated Date: 2015-01-23T22:09:55Z
Creation Date: 1997-01-30T05:00:00Z
Registry Expiry Date: 2024-01-31T05:00:00Z
Registrar: TLDS L.L.C. d/b/a SRSPlus
Registrar IANA ID: 320
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.SRSPLUS.COM
Name Server: DNS2.SRSPLUS.COM
DNSSEC: unsigned
>>> Last update of whois database: 2021-12-24T08:37:52Z <<<